General Information

  • ID:  hor006483
  • Uniprot ID:  Q9NRI6
  • Protein name:  Peptide YY-2
  • Gene name:  PYY2
  • Organism:  Homo sapiens (Human)
  • Family:  NPY family
  • Source:  Human
  • Expression:  Expressed mainly in the testis and prostate.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MATVLLALLVYLGALVDAYPIKPEAPGEDAFLG
  • Length:  33
  • Propeptide:  MATVLLALLVYLGALVDAYPIKPEAPGEDAFLG
  • Signal peptide:  MATVLLALLVYLGALVDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9NRI6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q9NRI6-F1.pdbhor006483_AF2.pdbhor006483_ESM.pdb

Physical Information

Mass: 400308 Formula: C162H256N34O45S
Absent amino acids: CHNQRSW Common amino acids: L
pI: 3.74 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 18
Hydrophobicity: 96.97 Boman Index: 3103
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 139.09
Instability Index: 1756.06 Extinction Coefficient cystines: 2980
Absorbance 280nm: 93.13

Literature

  • PubMed ID:  10756099
  • Title:  Peptide YY-2 (PYY2) and pancreatic polypeptide-2 (PPY2): species-specific evolution of novel members of the neuropeptide Y gene family.